SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g02450 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g02450
Domain Number 1 Region: 143-216
Classification Level Classification E-value
Superfamily EF-hand 0.0000000167
Family Eps15 homology domain (EH domain) 0.045
Further Details:      
 
Domain Number 2 Region: 1264-1353
Classification Level Classification E-value
Superfamily EF-hand 0.0000000232
Family Eps15 homology domain (EH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy11g02450
Sequence length 1607
Comment chrom=[bathy_chrom_11] coords=[;459167..463990;] status=[complete sequence]
Sequence
MSGSSFDWSSRQSLIQTLSSPALLDALFSNLRHGKLDGGGGESDESVHSSVVKGQKAVAF
LRPSGLPDATLSRVWRNGTNGTGEISDRDGLRRVLTLVKEALEEEERRRMTSSGAAADGG
LMTMTSGGLTPTSVSSNSIQSKPMSEKDKVKYEKHFSSLDVNRSGMVTAENAVQFLGKAS
LPEREIREIVRKRSRGAMSLTCDAFSLAMHDVYAVIKAKGSGGHGVTPMVSGNSGAGANS
TPGSVMNAQFASLNTPQNQYDVSLDTFVTASRNNNNNNNSINNTTLARLDTPDTYSRPPL
DLGFSMDNAAVATPADPREQAKLEKELNQYESKVSQSDQRNQRARDAIESTRAKVDKMRE
AAERAEKNAQEAKREAQSVIEDAEKKRSEYRTRAMTAKARVEEQMREKEKQMQVANRDLE
KLRQKVEQAESVSALPLKSMESKLRALQFEVTRVKTAAKNRQDALSAELVRKGAEIREME
RLKAAAIQDAENIERQFKEKREQSEQALERGKQALEAAKKSTLNAENQHFERVERVRELL
VDAKKEYVKEKEALVAAKKKFESELAKLEEERAQAAQEFESQRIVTKKARDAHRLQLQNK
RIMLEEASDALKEAKKQRDVIEAEHKASLATANENFQRTETRLNAEKAKLKQTEEKHKGV
LKDIEEKIESAESRTEDIIRQIENADRDLEKRKNELETRLEVATESLEKTEEELRGTKLR
VDAQREELDLREQACQEKEAEAENAAESSKSLIKSMEEDVNELRTKIEAEEKRVNEETSA
VQRDLEAKRAHLELETTKLEAALDRARDVFPRESAAAQQAYALEAMIATTESAREEAERS
AAESEAQSEKNMARLMELAEMVGNANTELKSSSKFTGGETFSFTTAAAEETTSTSSFEFA
SGASPFAESKELKSDAPEPFTGGFAEAEDVFSPQVNLKKSSSANAFAFDDGGTVMNDADF
GDEFDAFAKPKATGSSEQPLFSAHSAPAAVEDIDGDDPFDVDFGTNKNTATAAEDNLRKE
AKEDDAFFKDFGDDAFPPSQQMERESSKENVEWFEDGMNNSIDHEQQQHDLDDDDDDDDG
IFGRPIAANDGGRMPPEDDLAFEEEDFFAPIAQKPVQSFEDFNDTIGDRGEQQTNNGFED
TNDTDDAFKQPGQLGRNKFDDDDDAFNDEFSGDFNSREDNNGANNNNMNDDGFSDDFGDF
ESSRQSVEAAGSFTNKALKTSNVDTTFDDDATDEDDEPSSPNRQQQSSVAVPEITEDVGD
KENELPLYISRDDLERSKNAWYTLRKSLNDPNALGVTGAQVAAMATKTGLPNEKLAGMWN
ASCTSDGSSLGLGDFCVFMHLLKHALNGGSMPDFRIEGSFREEMLGADIVNEEARVTNEA
KGSFLKDEESETEKSAKEQQQQKQQQQQQQQQSMPPPVNIATPPHAQSQQQQQQQQQQAS
PTRRSAGGQHSPTRRGSDALPIEGQSQRLKVFIDSVANVKDASKMQQVHCKVSLVDTNGQ
ELEQPQNTAVGARPGNDANSLTLQNAVTLSSAPATWPAGSAVLIELRHFKKKENKVSTRC
WSFMEKESVRPGLFGLPLAKKPADPLRQRVALFNKGTPDLKLRFSFV
Download sequence
Identical sequences K8EK98
XP_007510322.1.44737 Bathy11g02450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]