SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g03210 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g03210
Domain Number 1 Region: 428-531
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 3.01e-19
Family FAD-dependent thiol oxidase 0.003
Further Details:      
 
Domain Number 2 Region: 40-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-18
Family PDI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy11g03210
Sequence length 651
Comment chrom=[bathy_chrom_11] coords=[;606606..608561;] status=[complete sequence]
Sequence
MSSKLDVGLLFLFLIAIISSHALSSLAIRVISKDYRQLAPTAIHLTNETFEEEFSNLSPQ
SFCVLEFYAHWCPACRAFAPQYELVAKYFNVAPRPEPKVTAFAVDCAEEQQLCARWKING
YPAVFFGTAIEFAGERANDVKEIKWKEKEKRTKTGAKQIVEFVGGLVIPSTEYDFSDEEL
DATSKKDGGGAATTTKENENLARLAFQNDQKKGLDYKTVRTMASKDDLERATVEMWNQIV
YDAEIASRELNELSLSSLKSSTNSASSIEANAQGGDVTHSTLADKARGNVETIKNAIGSL
IHALSKTHPIAECRASFRGLLPGADGTEGEEEEIEDESSSNRSNSDAESIDEEALESADD
PLLAMASSFSSKKGGGKRRKTITIHHHLFWDEETNGLSQFAAKTFTPCGRVKAPEWNDCK
PSSPNSSSRGYTCGVWMLLHATALRSKELDKHQGGHVWYDAFVNGFIRKFFNCLECREHF
LKMAEETKGFEIETPEEIAFWIWRRHNDVNERLATEGDPAGDPEYPKQQWPDVQSCAKCR
HTDGSWNDDNVLKFLQVYFLANNEPRPRSTRAKLVKVKTSSASTTTSLSTKRNRRGEGGG
HIVALNILAKVFVVFAALSFIFLYLHSKDKLPPVFERFKRKHMKRVFDDWP
Download sequence
Identical sequences K8EKD4
XP_007510362.1.44737 Bathy11g03210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]