SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy12g00490 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy12g00490
Domain Number 1 Region: 180-333
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.65e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 80-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000299
Family Glutathione S-transferase (GST), N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy12g00490
Sequence length 362
Comment chrom=[bathy_chrom_12] coords=[;91778..92866;] status=[complete sequence]
Sequence
MHTTPTGSEEEAEEKEQKKEEQKRVAEEDIIMKSRLLSNAFKCLSPGQTRHMSSSLGNSI
QSAIDIAKESEAEALKNVPKMTYYSAWFCPFAHRATLALERHRGFLSYEWVESLGWEKRS
KTNEEIKTKHENWYHYKSPDLLKANPLGMVPTIKDEFNNVITESIVCIQYIDEIVNGGKE
PILASSAAERAKERVMADFVAKTICSKYYSVLVRQEETEQLEAFGEIEKAIEKFATHLVD
DDDVMIDGEKREKGRFFNGRQTPGLVDLTLFPWAWRLPVFETHRDERFKIDPAKSVGLRK
YMRWLRDMVSRDDVSRTLPNWEEYLQHITRYADGSARSKVANAVRDGRNAHEYDDEKDDV
KE
Download sequence
Identical sequences K8ELU4
Bathy12g00490 XP_007509911.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]