SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy12g01100 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy12g01100
Domain Number 1 Region: 93-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.51e-22
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy12g01100
Sequence length 368
Comment chrom=[bathy_chrom_12] coords=[;207896..209002;] status=[complete sequence]
Sequence
MMIASFPNTTSGGGKEDAGEKKNTKKEPHKPHAGACSTWIDDEIEMMPEELQNVMPRPSC
CEKDEAEQREASRLIKILKGVDRVQLKADAKAQFIVGDDAHQQQQQQFLLLQQQQQLQQQ
QTNEDEDEDSDFGNTDDEDEESDPYLRELKAARIREMRLNAMKAEQMQKQAEYVNARERD
LGDILKKNAKVLCHFTLDGVDECARIDEVLDNLAKAFPKTKFVRIRPELGSKSPTLQMCN
VSQPPAIVYFKNRRLSSWTNGFDQFGGRNGFSEESVTKYIAGIGALPGHPDAPRRNSGAK
GSREEDEYAYFDSDDDGERSDDGDDEIFGANEPCPDCGRTYPHKHIRALRPGGEGAAEEE
SDENADSD
Download sequence
Identical sequences K8F200
Bathy12g01100 XP_007509705.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]