SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy12g01980 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy12g01980
Domain Number 1 Region: 211-360
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.82e-41
Family Glutathione S-transferase (GST), C-terminal domain 0.0000416
Further Details:      
 
Domain Number 2 Region: 123-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.27e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy12g01980
Sequence length 371
Comment chrom=[bathy_chrom_12] coords=[;358040..359155;] status=[complete sequence]
Sequence
MSARCTKRGESLLRRMIQTTTAKTTAPASNARYFRSALSNNDIAFTNGRRVYSSFDWSSS
SSSSSSSKSSGAAFAGAAATATMMMAYFLPSSSWSSSSSLARCEEAKKEAKMSSSKGGMP
FESVTLYQYDVCPFCNKVKAFLDYHNIPYDVVEVNPLTKTEIKQFEHEWKKVPVLVVDGK
ATYNSRDIINEVDERVRKHSGLTKRWFGEKSKKEKEKEEEWCKWVDDRFVHVLTPNIYKT
FREAMESFDYITERGNFGFFERQSARITGAVSMYGISKMVLKKRHGIEDERASLFEETRK
WMSEGVGQSGGKFCGGDAPNIADISMFGVFRAVKTFQTFEDVCKEVPEMVPWYERMQKAV
GESSRSDGLSN
Download sequence
Identical sequences K8EMD8
Bathy12g01980 XP_007510029.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]