SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy12g03170 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy12g03170
Domain Number 1 Region: 97-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.54e-37
Family Glutathione peroxidase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy12g03170
Sequence length 255
Comment chrom=[bathy_chrom_12] coords=[;577463..578230;] status=[complete sequence]
Sequence
MNASPCVPKSSSLLNSRATRLLSSFDRKTSSHSSQKKMMTTTRSFVVKATKDVGRVATTT
TTTTNRREIIMTIATSVVALNTTTNKAYASESLGNVNVGDKAPEFTLPATGGGTIALSDI
LAENDYAVVYFYNQDGSTGCSIEAERFNQAQEQFKAKKARVLGVSMDSIESHEGFCDKKG
LTFSLLSDGDGAVSKAYGAELTLPIFGKFSDRQTFLVGKDGLVKAKWKEMGAKVDEEKMA
SVKSTAHVEQVLAKM
Download sequence
Identical sequences K8EKW3
XP_007509742.1.44737 Bathy12g03170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]