SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy13g00670 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy13g00670
Domain Number 1 Region: 58-604
Classification Level Classification E-value
Superfamily SIS domain 1.42e-185
Family Phosphoglucose isomerase, PGI 0.000000000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy13g00670
Sequence length 635
Comment chrom=[bathy_chrom_13] coords=[;198627..200534;] status=[complete sequence]
Sequence
MSSSASGAVLKNATSFFSAKTIKTNKNNTLKNKKRMKPSSKAATAVLQTEHKGSLISSTS
EWNSLKEHVKDIEKTHLRDLLKDYNRCENLTLEHDGVYVDYARQRVTEETMEKLYALARA
SGVKEKINAMFSGEAMNSTENRAVLHVATRAPRSKVINVDGSNVVPDVHDVLDKIKDFSD
RVRNGEWVGHTGLPLTDVVCVGIGGSFLGPLFVHTALKTNQSHAADAQGRNLRFLANVDP
VDVARALNGLNPETTLVVVVSKTFTTAETMLNARTVRQWIIAALGKEAVSKHMVAVSTNL
KLVSEFGIDPKNAFAFWDWVGGRYSVCSAVGMLPLALQYGFETCEQFLKGAWSMDEHFAT
AEFEKNLPVTLGLISTWNVSFLGCDARAILPYCQALAKLAPHIQQVAMESNGKGVTIDGT
PVDYPTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVIKSQQSVYLKGEIVSNHDELM
CNFFAQADALAVGKTPVELRAENCPDTLIPHKTFTGNRPSLSIMLPELNAYTTGQLLSLY
EHRVAVQGFVWGLNSFDQWGVELGKVLATRVRATMHDKRNEGKMLDSSDGYNHSTERMLN
RYLQGKAQLKYDTPSDVFPCDLINSEECRPPSSYA
Download sequence
Identical sequences K8ENB0
Bathy13g00670 XP_007509641.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]