SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy14g00250 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy14g00250
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.04e-30
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy14g00250
Sequence length 167
Comment chrom=[bathy_chrom_14] coords=[;49483..49986;] status=[complete sequence]
Sequence
MERLGHGSYSSIAEEDFLSAVTSSHTCVVHFSLDEFERCKILDKHLQSLSQKYFQTRFMK
ANAPDLPFFTEKLNVKVLPCLILFKNGVAFDRIVGFEDFGNKDDYKTMALEKRLLEAGAV
EEEEKAIEEEEKGDEQIDKEEVMRELANRRMKRGFHKTESDEDSDFD
Download sequence
Identical sequences K8EP10
Bathy14g00250 XP_007509242.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]