SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy14g02780 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy14g02780
Domain Number 1 Region: 40-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-29
Family Glutathione peroxidase-like 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy14g02780
Sequence length 189
Comment chrom=[bathy_chrom_14] coords=[;499682..500138,500350..500462;] status=[complete sequence]
Sequence
MALIQKHAVTPSHPSIRKWRHRAQSSCMKKNTTVLLLLDFIQLNTLAEKYGEDLIILGFP
CNQFGHQCYEKDFELLNTLKYVRPGDGYAPKFQLMTKSVVNGDEQEALWTFLKDSIPYPC
DDRGGTGSDFIYKTQPNDKPIQWSPVRRNDVSWNFEKFLIDKEGVPFKRYSPKFENKDIV
PDIDSLLNK
Download sequence
Identical sequences K8FCS5
XP_007509346.1.44737 Bathy14g02780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]