SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy15g00470 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy15g00470
Domain Number 1 Region: 86-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-48
Family NQO2-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy15g00470
Sequence length 316
Comment chrom=[bathy_chrom_15] coords=[;80618..81568;] status=[complete sequence]
Sequence
MTSSDLFFTTTTTTTSKKNNGMNNNNNNNKRNTNSNTNTKNIFKQQTSKTNNNQTFSHVI
NERLYSVGLMVHRDSAENNSSLKWEFSKENETKVQTILKRYPPNYKRSAMIPLLDVAQQQ
NAGYLTVPVMNHIAELLEVAPIRVYEVATFYSMFNRSKVGSYHVMVCGTTPCMLRGSRDI
EKALSEHLGVKKFETTRDGKFTLGEMECMGCCVNAPMIAVADYTGGVEKYTYNYYEDLTP
ESAVSIVQTLAQGKMPEKVGSQIRNKAEPITGTTTLNTEPTGPNCRDLAKLKKELEAAAA
EAAKAAAAEAAAGAKK
Download sequence
Identical sequences K8F5G4
Bathy15g00470 XP_007508969.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]