SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy15g01560 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy15g01560
Domain Number 1 Region: 8-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000291
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy15g01560
Sequence length 133
Comment chrom=[bathy_chrom_15] coords=[;288687..289088;] status=[complete sequence]
Sequence
MSIRGIFQLSKLTFVHCPHTGTSKGINQFLVNALPSLRIQTEERRGEEHKNVFEIQQRKG
KDPYLRAMFVNKREKTIGVKNKTEEEIAILVENVMSEKGRAVKKIPRRVMRTRISSVQGT
WQPQGASTSSSST
Download sequence
Identical sequences K8EP45
XP_007508740.1.44737 Bathy15g01560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]