SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy16g00270 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy16g00270
Domain Number 1 Region: 132-293
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-29
Family Glutathione peroxidase-like 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy16g00270
Sequence length 295
Comment chrom=[bathy_chrom_16] coords=[;50395..51282;] status=[complete sequence]
Sequence
MFSVVASLPTTARGVTTRITTGLRLRGREEGDDVGRRRRQQQQQCCSSLCFCCCGADGGK
TFTSPDEKKRPTKGRRPFLSSPPHLTTTKTTRTSSRRVFDVSTKAVAYPNEREDKQQQQQ
QQHEREHHQQLIKKGDRIPTSSLQYFDHEGNLQSIETSQLCSKGKTIVVFAVPGAFLPTC
TNKHLPGFIDLAAKMKQAGCDLIACVSVNDAFVMDAWGKAVGAAPVLMCGDGSGDFTRKL
GCELDLMDKGLGVRSRRYAMIVKDGIVEYIEMERGGAFTRSRAEDVLQVLEEIKS
Download sequence
Identical sequences K8F696
Bathy16g00270 XP_007508718.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]