SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy17g00200 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy17g00200
Domain Number 1 Region: 4-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-30
Family Thioltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy17g00200
Sequence length 202
Comment chrom=[bathy_chrom_17] coords=[;40902..41510;] status=[complete sequence]
Sequence
MSKLNEEDLEDARRKRMEEMRGNQSNRKEYLKRQHGEVHQILDEKEFFGKMKGEEKMVCH
FYRNSEPCKVMTKHLRALAPMHLETLFCEIDAEKSPYLTEKLKIFMLPTLALVSKEKVMD
YIVGMDDFGGGGDDFPTKNVKLVLQSKGMVDEEGERMYALKARNNGEDDEHAAEVLKERV
KNIRQGKKFDLNSDDENSDFDD
Download sequence
Identical sequences K8F6S4
Bathy17g00200 XP_007508431.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]