SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy17g02310 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy17g02310
Domain Number 1 Region: 114-269
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000437
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 38-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000704
Family Glutathione S-transferase (GST), N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy17g02310
Sequence length 287
Comment chrom=[bathy_chrom_17] coords=[;463277..464140;] status=[complete sequence]
Sequence
MRAHLHDSKDLWSTTLHQTLLCNCIEGEDDESDCAFHFQYMPMRNRIEVPRMLCEARKCK
YALELVGFVPWGSDVKTTTPYGKTPTLKNYDKTKTKDLAHEKPIARYLASKLQLFGRDED
ERAKIDEVYEQHWSTLRNNGLTHQGENFDMDQLLAITDREIDETPRFQDMRRVNSFSPSQ
RSLASLRVFDEILLQNQSMYLVGDALSLCDIALFETAYELFREESADFDIGERFNLKYLE
RFLAHIEDEHPTLREYMKSARRVPRYKRPGYVYINEQVKYWTSFYAT
Download sequence
Identical sequences K8FDD9
XP_007508274.1.44737 Bathy17g02310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]