SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy18g00910 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy18g00910
Domain Number 1 Region: 53-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.98e-23
Family PDI-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy18g00910
Sequence length 262
Comment chrom=[bathy_chrom_18] coords=[;176272..177060;] status=[complete sequence]
Sequence
MRNSIKFLAYVLSIASVSLRSDDKGNAGVLVFRSVSASSAAETTTTTSETTASDDDGAIE
LTPTAFRAQLQAKPSDEKYFAKFYAPWCGHCKSMAKDWDALAAEMKSEGRSDLKLFSVDA
STQAEASVAKEFEIKSFPTLMYFEDGKMFPYSGGARTKEALGNYLASENKKDARKFSFKG
ESFKLQQPGVFVRAKKFWEESLQVIAQVYKHKAGAVYVLYGAGLVTGISFASLFFVVVQR
TGGDGKKSKAAAKGKGSAKKTN
Download sequence
Identical sequences K8ERD2
Bathy18g00910 XP_007508120.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]