SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy18g01430 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy18g01430
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily CBS-domain pair 8.84e-19
Family CBS-domain pair 0.0013
Further Details:      
 
Weak hits

Sequence:  Bathy18g01430
Domain Number - Region: 14-37
Classification Level Classification E-value
Superfamily EF-hand 0.1
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy18g01430
Sequence length 147
Comment chrom=[bathy_chrom_18] coords=[;283878..284321;] status=[complete sequence]
Sequence
MHAMDVGALVVMDFHKLDVDKSKKIHLEELYYSPKSNAIAGIVSERDYLRAVATNKVTDL
TTVREIMTPAEDESTGEKRLISVEPYCSVLAAMQAMTSGHFRHIPVINTESQTLEGIVSL
GDVVKALIAEQDEEIDVLEDYITSGGK
Download sequence
Identical sequences K8ERY7
XP_007508233.1.44737 Bathy18g01430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]