SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BathyCg00085 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BathyCg00085
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.5e-16
Family 7-Fe ferredoxin 0.000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) BathyCg00085
Sequence length 81
Comment chrom=[bathy_Chloroplast] coords=[;25394..25639;] status=[complete sequence]
Sequence
MSHAVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASAPRTEDCVGCKRCEAACPT
DFLSVRVYLGSETTRSMGLAY
Download sequence
Identical sequences A0A1Y5I4K1 C1KR77 K8FHK1 Q0P3P1 S5QBM3
MES00004779184 70448.Q0P3P1 BathyCg00085 YP_002808655.1.63511 YP_009056876.1.44737 YP_717214.1.19543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]