SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g00030 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g00030
Domain Number 1 Region: 80-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.29e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 173-278
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000223
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy01g00030
Sequence length 465
Comment chrom=[bathy_chrom_01] coords=[;3323..4720;] status=[complete sequence]
Sequence
MSSTSSKKKRITNATVVEVDGSNAPSWKDLERIATDLKKKHDIPETIDLEAGPTSPKCLK
RTFGKTDEEIRVHFYRDHAGWCPYCETVWLLLEEKRIPYTVEKINMRCYGDKPQSFLKNV
PSGMLPVVVIDGVLMTESAVIQEALETKFSDVASYPAMLPPNESSEAQTLFRLERKLFSN
WMQWLTGNWNDAASRATFCETLDEVDLRLSETVDSPYFLNSGFSLVDIKFAPFLERMAAS
LLYYKGLRIEGSKRWPHIDNWFANMSNRPTFRMIRSDYFTHVHDLPPQLGGCVENNTQEQ
IDAMSAINGRDGKSWQLPLPPLNESSLEPLWEKENPERDRLEAAIQLLSNYENVSRFACR
GASATPSKKRVSAPLSDPFATPNEDYVEAVDVALRTVAAMLLRTDNSDIPQGCENVLGTN
ASQVTKKNVSLSLEYLRDRVGVPRDMRMPAARQLRSHLNFAISHL
Download sequence
Identical sequences K8E8R2
XP_007515112.1.44737 Bathy01g00030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]