SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g03600 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g03600
Domain Number 1 Region: 183-282
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.08e-25
Family Thioltransferase 0.0011
Further Details:      
 
Weak hits

Sequence:  Bathy01g03600
Domain Number - Region: 71-102
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.034
Family GIY-YIG endonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy01g03600
Sequence length 282
Comment chrom=[bathy_chrom_01] coords=[;671371..672219;] status=[complete sequence]
Sequence
MRTLQLSPSRQSAAAANNNNNSATKRQKRRSVVVVRLSARAENDDDGMMMSTLPLIDIQF
EGFNSPDIPASPGIYAIYNDKKELQYVGLSRKISASIKMHCFELPAECGFAKVLPMEEAT
KVDLQDGWKRWVMAHVSESGGSLPPGNTPKNELWADRKKRGPSKPSLRLTNGMTPDMSFD
ALKPKIQEAIDEHKIVAFIKGTREEPECGYSHRVVNALNSLLLDFETVNVLDDKYNPNLL
YVMKEFSDWPTIPQVYANKEFLGGHDIIVKMFEKGELKDAFK
Download sequence
Identical sequences K8E8N6
XP_007515113.1.44737 Bathy01g03600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]