SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy01g05400 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy01g05400
Domain Number 1 Region: 65-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000142
Family Glutathione S-transferase (GST), N-terminal domain 0.0088
Further Details:      
 
Domain Number 2 Region: 153-271
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000311
Family Glutathione S-transferase (GST), C-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  Bathy01g05400
Domain Number - Region: 327-450
Classification Level Classification E-value
Superfamily Globin-like 0.000348
Family Phycocyanin-like phycobilisome proteins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy01g05400
Sequence length 451
Comment chrom=[bathy_chrom_01] coords=[;981550..982905;] status=[complete sequence]
Sequence
MRMVNTTSASSSSSWADLQSKSESTETGLKMKEQAEQRKGGKAEPHVDNLLHLYSAKSED
DVRLTLYRDHAAWCPYCQKTLLMLLIKRVPFRVEKINMRSYGDKPKAFLDKVPNGLLPAI
ELDGELMTESLQIMARIEREFTGPEYKVMVPEQEFDRVNQLLGMERELFGAWCGFIFRPS
MPFGVGGARGGFEATLDRIEQALGVTAGPWFLENQEHPSLVDLQFVSHVERMNASCVYWK
GLNLRGNSRWKNIERWFQAFEEIPEYRATKSDYYTHVMNIPPQYGPGYEDNTAEVKEAMR
IINGEGDSWRLPIQLNTNSLEPINACDVGKEEEARHEAAYKLISNSKNVARFACRGAGEA
GRKQFQAPLADPYAVPNEKYVDSVDAWLRIVADAMLDGSAEPLQPSEPKKDKEIAKCLRY
LRERVGVPRDMSYPAAMQFRAHLNWAIDQLD
Download sequence
Identical sequences K8E983
Bathy01g05400 XP_007515373.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]