SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g01000 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g01000
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.53e-41
Family Thioltransferase 0.0000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy03g01000
Sequence length 126
Comment chrom=[bathy_chrom_03] coords=[;166885..167265;] status=[complete sequence]
Sequence
MTNLVLNTHRLNVLFSSLLKGVTSVVNDQTFEQDVLKSDVPVLVDFWAPWCGPCRMIAPL
IDQLAEEYAGKLKAVKLNTDESPSIATEYGIRSIPTVMIFKDGKKMDTVIGAVPKSTLTG
TIEKYL
Download sequence
Identical sequences K8ECB3
Bathy03g01000 XP_007514205.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]