SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g05000 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g05000
Domain Number 1 Region: 78-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000457
Family Glutathione S-transferase (GST), N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 183-287
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000268
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy03g05000
Sequence length 364
Comment chrom=[bathy_chrom_03] coords=[;946140..947234;] status=[complete sequence]
Sequence
MTVAPKKKKTKKTMFNKKGVVAMFSSSSSDLSSSVSSFQNDAKLLGDDDDIDDIDGRTSS
SSSSSSSSSSSNTERRSEKHPHEKIVFYTHSLCPYAHRVRLCLDELHLLREEGGKVDIVD
VDLSNKPKFFLDMTNGRGVVPLIEFSETGELVSESLRINERLWEEYYSDDDSSSLTSSSS
SSSPSSYEDAKRFANACDQKFVSLGLQAIGGGWSFDTTRNERTLERFEREIWEIDALIEK
HNDDDNSNTKRKVFLFGGDRASLADVAIYPFAERFELALQHFQGYTLGNVEYYHPPSPPS
SSSSSSSSKHHQQPRHFQKWLKTMQTQPSSLRCAVKNQDALLKSWSRTKRLDYFDYESAD
YINP
Download sequence
Identical sequences K8ETI1
Bathy03g05000 XP_007514338.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]