SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy03g05120 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy03g05120
Domain Number 1 Region: 892-1177,1209-1353
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.15e-108
Family Trehalase-like 0.000000402
Further Details:      
 
Domain Number 2 Region: 184-294
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0092
Further Details:      
 
Domain Number 3 Region: 112-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000141
Family Glutathione S-transferase (GST), N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy03g05120
Sequence length 1404
Comment chrom=[bathy_chrom_03] coords=[;976862..980161,980225..981139;] status=[complete sequence]
Sequence
MNNKKKTNTSTAPKKGGFTGRWRTTRTMMKAEMDDDLESRRHHHPQRRRKNISASFSTRA
TRRSASLSASSSSEDENTNTNYNNSSSSSSENNTRNTNNNENNNTTNTNDEFILYGSQGS
RSPLINWYLYEKEVQFELKEPRDVSNPHPFGQVPALRHKENVELFESGAILLYLADKCGE
LKSDEAKANAYSWVLWANASLDPICFKEDINGRVIDTGIKNETKGMRRLDDVLSKREWLS
GDQFGVADVAVAAYLLYVPQFFQGVSFKRWPNVAKFMGRCCSRDSYAKAFGPRVQSYLIG
ELMKDSRNIYSFTARVSSLFLSRFAPIYYNGEREKEETQNSHYNHTITIIIISAFTTTTA
ITTRATSWSSSSRTSSSSRSSALFAIQQRQNSGVSSCVSPTTTCRWFPPRRRTGFEERTH
HHHYHRRGKATTRGSVLILNAFEKQNENKDEEEKEKSFFEEDFERLRQTLDNEKKMMMNN
TSSSFDEKGRRVEETNNTNEKNNFATTTSSKAAAETIDGRGKTIQTQTTTTRKAPFKNPL
LDDEIGLPPRSDSPAIDISFAHGFDSHHHHLTSVQEVYTNAAILDAAHQSMNFLDSKDFV
DTEIRTSASLTISNFLNIGNNRLGEGGMIGSGRGEESTSVGAAAGASGRDQIMERESETN
EEVMKQFFEGHFYSGPSGLNDMGVNVGNGNGGSGEEGTVANALVHLLHDWTEVPSVIANL
LHPEILAENGGGGTVKLSTSMGRLNSIQEDEEEAAMMGKSSSAKKGGGGLGEVDDDEAYK
HHAKAIQLARHCNNTWPLLARSVAPSANQRQATPLEYATGSNTPRGPIPNSPLASPKKSR
TMAANQQVQTAFSGGGSSSSTNDRVSALTGSLKSKLQINPAFPQKQPPHMPPQQQKSSLI
PLPHVAIVPGERFRETYYWDTYWVALGLLESDMYSTATGVIRNLLSMVERFGYVPNGSRV
YYLNRSQPPVLATAVRAVYESTRDIDLLKYAVQLLQREHKYMTRPEKCINVVSQQTGNLH
TLSRYWAYTEKPRPESYREDLDTAKEFCNKFCDSKDSKEKTDRLRADLFRDIASAAESGH
DFSSRWFEDRQSIRTIRTTKIVPADLNGFMYKMERDIAWLARQLEQNVESVEEVEYAQEL
ATQFEIMAETRRNAIYEVIWDDSEKRWRDLILRRSKFDTYNIDGTTTDPSLHKNNRFDDP
DAVYEYSFAAGPYASDWVPLWCGVFEKNSKEALDACESLRQSPIVDVAGIACSTVKSGEQ
WDFPNVWAPLTHMLVEGVSEYGGEQNEVYANFAKNEAHKYCKSVSKGLRLTHAMHEKYDC
RFFGAIGRGGEYAPQTGFGWTNGVALAFLAKYGGWNEEEEDEETEAPRMGLCETQTCEDF
FSDSSGGDDAYSSSEEDEQYRYSD
Download sequence
Identical sequences K8EC12
XP_007514014.1.44737 Bathy03g05120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]