SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy07g03480 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy07g03480
Domain Number 1 Region: 43-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.11e-27
Family PDI-like 0.0011
Further Details:      
 
Domain Number 2 Region: 425-540
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.61e-24
Family PDI-like 0.0025
Further Details:      
 
Domain Number 3 Region: 294-449
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000353
Family PDI-like 0.029
Further Details:      
 
Weak hits

Sequence:  Bathy07g03480
Domain Number - Region: 200-304
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000597
Family PDI-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bathy07g03480
Sequence length 596
Comment chrom=[bathy_chrom_07] coords=[;679135..680925;] status=[complete sequence]
Sequence
MGGMGGMGGMGGMGGMGGMGDYGGGDYGDYGGQGEEEELEMPEGPYEVEPLGKENFTSIL
KDLDGALVEFYAPWCGHCKKLEPHYEYAARAVKESEKLEGKNVKLFKVDATLEEALAKEL
GVEGFPTMKWFEKGELKKDYQSGRDQYAIANYVERQMGEPSVDLTTMKVFTGEEAPKKVK
EAKEDGDEGEEEDEDEDEDEEKRATLIAVFDELGSSPAFADFYAMAKDIDLDGLDVAHTD
NRANVAKLGLTNFKRPSNPAMVLMFENEKGQKSFAEYDGKWEAKEITKFAAVAQLPWVIP
FEQEYINKVFESGVTAQVLVFHDGENEETAKELHALLEEVSKEDNKSGKILFVTVDIKGS
DAEGVLEYFDVVVGEDEFQPQAVIFSQPSEPEPVNKDEKEKPRIEEGQKKYKLENAPTIT
KPIMQQFIKAFEAGLLQEHLKSEPIPEENYGPLYKVVGENFDEMVNDSETDVFLEVYAPW
CGHCKELAPTIKKLAKRFKDVPTVKICDMDGTANEHPLVKDAKGFPAIYFFPAGEKGVRV
PWDEEEKRTVGGFTRFIQANAKLPFDLPKIKSKEEKAAEREAKKKAKEFEEAHEEL
Download sequence
Identical sequences K8FHP9
XP_007511961.1.44737 Bathy07g03480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]