SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy08g03210 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy08g03210
Domain Number 1 Region: 51-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-29
Family Thioltransferase 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bathy08g03210
Sequence length 155
Comment chrom=[bathy_chrom_08] coords=[;590735..591202;] status=[complete sequence]
Sequence
MTTSGASKSFASSSSRFFLKSRTLSSSKRRSSFRRRYRKTSGQIECSTKKTFTSFQELID
ESEIPVLVDFYATWCGPCKLASEMCGKFASQTEFKDKVKFVKIDTEKYVELSSKWKVEGL
PTFVLFHKGKVLDRIEGLPTEQQMKDRLLYFLQQV
Download sequence
Identical sequences K8EYB5
Bathy08g03210 XP_007511349.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]