SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bathy11g03840 from Bathycoccus prasinos

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bathy11g03840
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.05e-24
Family Thioltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bathy11g03840
Sequence length 175
Comment chrom=[bathy_chrom_11] coords=[;718983..719510;] status=[complete sequence]
Sequence
MNMGRIDAKNEWWLKDASPNMIDINGTPELLEALCNNQDKLVVVDVYAKWCGACRALYPK
LCKMGRQFDGKMVLLKVNFDENKDMCKTLGVKVLPYMIMYKGNKGRVEEFSVSISKIKML
REKLDIYTTDIPGEGYSKDECNLEEFGDSVWGDVDVENDAPKDAEGAQETLLPKD
Download sequence
Identical sequences K8FAJ7
XP_007510293.1.44737 Bathy11g03840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]