SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_00105 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_00105
Domain Number 1 Region: 4-48
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000231
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 94-162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000399
Family PHD domain 0.0038
Further Details:      
 
Weak hits

Sequence:  Bm1_00105
Domain Number - Region: 257-295
Classification Level Classification E-value
Superfamily ARM repeat 0.00374
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_00105
Sequence length 319
Comment | Brugia malayi hypotetical protein, conserved (320 aa)
Sequence
MESNCAICLEQLKYPLGRPDNCKHKFCFKCIRDWLKKRSQCPLCGGEPKYLIKIEETKNE
RKVPVKKRTKEQFKNELHAQEQLENDQGGPSNEDITIEYANCRSCRSSDNEHLLLLCDGN
IGQNADGSTIRCNVAYHCYCLPEKLERIPENDRFCPFCENKPENAQHFVGQTNLNVSRSE
EAGSSSSRQLKNETDVSKCHLSGCWSKKLDAAKLEIPNQRLFQDAYGDSDTESESRDYSN
EKSELYSTSDATRTNFDVLDDDDDDDDDSDXGEDDDDDDDDCNESDETDSEQKFHQAIFR
DNYRRRRGMKRNQGITYRR
Download sequence
Identical sequences Bm1_00105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]