SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_00480 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_00480
Domain Number - Region: 1170-1280
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00011
Family Voltage-gated potassium channels 0.051
Further Details:      
 
Domain Number - Region: 564-609,833-882
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0113
Family Ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_00480
Sequence length 1306
Comment | Brugia malayi conserved hypothetical protein (1306 aa)
Sequence
MHYVRLATDDIDTVTYAQFKTYPIAIPITTTISTTNITNVTTTTTTATTTTTTTTTTIAI
TTATNEFIEPLRNDSKLKPIVKMKKESGNGARHVHCNDWREMLALVNASNKISANNYAAQ
TDKDASPKCFTSGPPDVCATPTSLTSTIHLRTRATSSTCSTSWDIPSAERVQNVGRSDEE
AEPEMTGGESEVGQSKQPTTXTTEKWSIRKHTALFPTDAYGTIEFQGAPHPYKAQYLRLT
VESNPADIMDLFESVWNVPAPKLIITVHGGMTDFDLQPKLARVFRKGLLKAAKTTGAWII
TAGINAGVVRQVAAAIDGSGSVSRVRSKIVTIGIAPWGLLKKRDNLLGQDAVVPYHPHSF
SPKGRFAVLNNRHSYFLLVDNGTIGRYGADVILRKRLESYISEKRTLGNGTRSVPVVCVV
LEGGTCTIKAVYDCVCTSPRVPVVVCDGSGRAADLLAFAHQYVQEDGQLPERVKPQLFSL
VQFVFGYDDDAAEKLLEQLMMCVRQRHLITVFRLGEDQKQDVDHAILTALLKEQNLSAPD
QLALALAWNRVDIARSDIFVLGQDWPKTALHNAMMEALINDRVDFVRLLLENGVSMGNFL
TIGRLEELYNTDKGPPNTLFYVVRDVVKIRDGYRYRLPHIGLAIEKLMGYAYKSSYTTEP
FRSKYLLYRNKXKKLRKQNQDSMRDSFISDGFVTPLANPDNLVTDSVLAAYSGNRALSHH
ILWRSRRDNPASNFGIMAPPKPVAVQETVIDIENESLCSDTEKDVDDFKYPFNELLVWAV
LTKRQEMALCMWQHGEEAMAKALVACRLYKSLAKEAAEDYLEVEICEELKNHAEDFRKLS
LSLLEHCYNHDDARTLQLLTYELISWGNETCLSLAVMVNNKQFLAHPCCQILLADLWHGG
LRMRSHSNLKVLFGLFCPLTIFLLEFKSREELLLQPQTAAEHENDLNDSSSSSSSSGTDS
SSDSDXSSDDEFQDNEQDGERRRNSAESTQSMNLAGGRRKRTRPHLKDGSSMSNGGNITS
PHEIIEISNVNSILAVTNGAGTVFNSPRSHARSRSITSIQSRISQQQQAGITPRKTPPKQ
ISTSKSNFDAYLLFLKERITHRETCSSLTNCVCGIMKGKNLQRKFDSSDHGNKSAPPSLS
KMVTIAGQTVPHMRPIKFRRKMYEFYVAPITTFWAWAITFCVFLCCFAYTLLVRTLIRPT
WLEWLVFAYVTVFGLEHLRKFIMSEPESFAQKAKYFFNNTWNLLATLAVATYLIGFGLRL
DVKHKSVRAIGRVVLACNSMLWSIKLLDFISVHPRMGPYITMAGKM
Download sequence
Identical sequences Bm1_00480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]