SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_00555 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_00555
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.8e-29
Family Astacin 0.0059
Further Details:      
 
Domain Number 2 Region: 156-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-17
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Weak hits

Sequence:  Bm1_00555
Domain Number - Region: 114-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0077
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_00555
Sequence length 289
Comment | Brugia malayi astacin protease protein 30, putative (290 aa)
Sequence
TGTIIHEVGHTLGLWHEQSRPDAEEYITVVKEYIIPSYISEFLTRSEHEITTFNVPYDLG
SVMHYGSTAFSIDQRSKTLLTKDPFYQMTIGQRDSLSFYNIKLINEAYCKGDCKEKNECK
NGGYLNPSNCQSCLCPSGFGGSKCEMHASSESNSKCGGTLKAIIDWQYIESPGYPDGYPT
NVICNWLIETDKEERIEISFEDNFGIFCSSTCVDYIELKIGNDLANTGYRICCYDKPNDS
LVSAKYQAVIIFRATTGEDTGFKLKFRKTMKPAQTTPSLPKTTTTGTRD
Download sequence
Identical sequences A0A0N4T9C2
Bm1_00555 XP_001891635.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]