SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_00885 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_00885
Domain Number 1 Region: 564-714
Classification Level Classification E-value
Superfamily Fibronectin type III 5.47e-19
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 329-460
Classification Level Classification E-value
Superfamily Fibronectin type III 6.62e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 3 Region: 165-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000491
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 60-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000109
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 730-821
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000332
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  Bm1_00885
Domain Number - Region: 12-56
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00215
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_00885
Sequence length 966
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (967 aa)
Sequence
MKPRDDDVNRNWEITGSVLTLKNVKKGIAGSGDNAVYQCKAENKHGYLWANFYLNLLAFK
PELLSDPGEIEAVIGQNVTLSCKFFASPNVNITWDSAVLHGLRHHIVPADADGEGKLIID
AVGRDAEGEYTCTGTNKHGTEKGTAHIIIREATRLEPFERPLEKVLAGQRLELSCRAQHD
ENLEVTYEWLVNGKPLIEQYIQSGHYLITDKNSLIITNPARYDAAIYTCIAKTALDSAEK
SVQVGVDDVPNPVHMAFLTKCDDTAQIASINFEYMEDIDFSAPIKEIWAQYQIDEETDVV
VWLTHPHPALADSLQTIDDNQRIVKGTIDVSLRPFGKYRFRVFGRNDFGDGAPTNVNGGC
ITPARVPDRNPESVSATGTRPENLIVFWKPMSREDWNGRNFHYIIRYRPAGSDAEWKEEI
VEDPYSDRHTIELSVEEPFRLYEVQVRAANENGTSNVSPQSIEGRTGEGDPGFTPTGFKL
ITSDSTSATFEWDSIDPQQVQGNFTGIKIIFWPEEDENESNENELETGNIVRLRRHSVLR
RSTGEVSTSQTNVYGEKRSVIVAPNKKSATIFGLQPNSINYAQIAVMNGQNDGTPTDPIS
FRTKEGVPTPVRNLEAYPMNGRNERESAIVAIRWDQPRHYNGRLTGYSVEICSINADGLM
EQRERCPIRKTQPGERFLRISNLENDSKYRFIVYGNTNAGRGDPNSKDVMTLPEDIKFFL
EPEQPHLEESGVGDDFINVTLAPGEFDKNEGRPVGSDLYVKYRKVGDDEWGIAEPKDDDL
SVQIGDLEPGTKYDVVVVSKQRDQSGNIRETESTVSHISTTGSAPQSARIWWLIIILLVI
LLLLIILCIVCVAARQRGAKYPVSEKERQQGRQPILPGIKERGFGEYIKPFSREDDEKRS
LTGSKAESETDSMAEYGDTDPGRFTEDGSFIGETNVYRFAGQYVPNKTLVSTTNDKPGRD
CASTFV
Download sequence
Identical sequences XP_001891696.1.25112 Bm1_00885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]