SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_01080 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_01080
Domain Number 1 Region: 1014-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.0019
Further Details:      
 
Domain Number 2 Region: 359-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 3 Region: 901-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 4 Region: 854-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 1066-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 6 Region: 291-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 7 Region: 806-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 8 Region: 547-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 496-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 10 Region: 962-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family EGF-type module 0.06
Further Details:      
 
Weak hits

Sequence:  Bm1_01080
Domain Number - Region: 1117-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1173-1220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 127-197
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00542
Family N-terminal domain of xrcc1 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_01080
Sequence length 1805
Comment | Brugia malayi Laminin related. see also lmb- protein 1,
Sequence
putativeXXXXXaaXMRPSHSVAQCALVLCFLFPSSVEHEPPEEDVCNERSCYPATGNL
LIGRKKSLSATSTCGLHGRQRYCIVSHLEEQTKCFYCDSRTEWKPNREPYKLSHRIENVV
SESYEDRNRNWWQSENGVQNVSIRLDLEAEFHFTHLIITFKSFRPAAMIIERSADYAKTW
TPYRYFAYDCQNTFPNIPERPPKKHTDVICTRRYSDVAPSTGGELVYKVISPHIPTENPY
ADEIANLLKVTNIRINFTKLHTLGDDLLDYRPEIDEKYYYAIYELVVRGSCSCYGHAQRC
IPMDNAARVSVPYRADMVHGRCECTHNTKGLNCEQCMDFFNDLPWRPAIGDDSNECKRCE
CNGHAARCHFDRAVYQASGFVSGGVCDECLHNTQGKNCEQCKPYFYRNPDRPITDPYVCL
PCKCDKTGSLNDGICEGEEDSERGLVAGKCYCKSNVEGPWQVSNFGAIPDSNFRCDHCKN
GFWKLTADDPNGCRPCSCDLLGSFNNEGCNKQTGECLCKQLVTGDACDKCLPEHYGLSDD
LYGCKPCDCDLGGSVDNHCDVITGQCKCRRNFSGRRCDTAESAYYCPSINHYTLEAEEAE
ITDGQIEFRELPVFVRDHTWTGDGFVRASEHTQLVFKIDNLAQSMHYNIIIKYEPMQDDI
GWENIQLTVVRPTDPSVDGVCKNLSPSDDFLTAKFHPNSGYVEVVPDVCLEADVPYEILV
QMGEKRTKVSDRTATVLIDSIVLVPPTEELFISQGISADNHHRVEYERSQCRTQQLSLTP
ISDLPDVCVRYICPVAAMLLNRSLECECDATGSRSGICSGKGGQCDCKPNVIGRRCDRCA
VGTYGFGPSGCTSCECDSVGSLNNNCNRQSGQCSCRERGITGRQCNQCQPGFWSFPDCRV
CQCNDHASICDQKTGACIDCLDLTDGYYCDHCKDGYYGDPRLGINLSCKPCPCPGGLDSG
FQHADTCYLRPSEHSEAPDVVCNCRIGYTGERCSSCAVNHWGNPNELGGTCEPCECNGNI
DVNVEGSCDPVTGDCIKCLHNTEGAQCEDCMEGYYGDAKIRSCQKCVCNDLGTNRTAGAC
DRVTGQCPCLPNVIGIACDLCAVHHFDLASGKGCEPCKCDPTGVILSDDGMSQLQCNELD
GRCYCKPGRGGRTCSDCEDYHWGDPATGECRKCECDRIGSATQQCDRNNGSCICLPGSGG
PLCNMCARGYTGQWPRCQACGECFQNWDEIIQDLRNQVEALIETAKNVEDTGVASVYDNE
FEKMENSLLDLKTQLESANITRRNVIGLQNEIDKLRQNINLKKELLNSVGGRITEISSNV
DGADLELKSLVEEADRLTEKSQAFQENATLLRVTDVQGAYNITRESAEKSSAAKLRTDQA
DLKITSAESSRQEAIQLLDNNQLDFEKQFSENEMALVRIDKQLANFETVLPMLNRDVCGA
ESAPCDQLCGGPGSCGHCGGRSCLSGSVSKAEMAKKFADEADQKLNEKQKEAEEVLGRIR
EILQQTFITKNKAKDGHDIAEAAARQEFIDNNQRSSPEQIRALAEEIKMAKISLTSDQIE
ELADQVRERLLNINNIDIILNETRGNKTIAEALQKSAELASMRAAEIRNTTTVVRQALQR
AGTAQEVAKGAIKNATEQVMDARNDLNSATDELRLVEISTAKTNETLVKLESAMKDINVQ
YLSISEDTKYAYEAADKAIRQAEFAEVASEQLEVSFEKAKELLSSQNIGNELPQARAEEL
RKRATQLLHKTQRHRSDISQLSANMDAFDVRLADYNRELSELHSRIDTVTTQVHKQIEYY
STCDI
Download sequence
Identical sequences Bm1_01080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]