SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_01150 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_01150
Domain Number - Region: 125-161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0211
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.021
Further Details:      
 
Domain Number - Region: 54-128
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0785
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_01150
Sequence length 308
Comment | Brugia malayi DHHC zinc finger domain containing protein (309 aa)
Sequence
MMVLRHRKVNXHELDVNNHDCVNLSVAEYQIIEAPDWDNGXAYDMKRDLGKTMTRRLFHW
GPLAVICITLTIGTATTYVHLQWWPLTTITSFLHLSLFLLFNYLTLINLSRSSFFGPGYA
PYNWKPPRKEDEDRLQYCRICDGFKMPRSHHCSKCGRCVCKMDHHCPWINNCVGYRNHAL
FVRFLASAIFGCIHAAIILSFALYRFLFREEQLLQKKYKRDNAHKVEIIREFPGGYCTSF
KFGISVWFCQPWSDEIRQMVRIGEIWMVTRVRKHWFYGALLDGQKATEQEKEKIIIRGWF
PRVCARRL
Download sequence
Identical sequences Bm1_01150 XP_001891747.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]