SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_01275 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_01275
Domain Number 1 Region: 239-344
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.26e-21
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 2 Region: 402-466
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000771
Family BRCT domain 0.034
Further Details:      
 
Weak hits

Sequence:  Bm1_01275
Domain Number - Region: 482-591
Classification Level Classification E-value
Superfamily BRCT domain 0.000411
Family BRCT domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_01275
Sequence length 593
Comment | Brugia malayi hypothetical protein (594 aa)
Sequence
MFASTLNHAEAFLKSICCDQWTCVNTICDGKSFPLCPQCLLPVGLQHMKSATFADQLFQN
LLSLKETLSDFTISQYDRQLMLSLVETDKQPRTVEEFCSTQECVKIEDDVNHTNINEQRN
GLPSETSPVSSGNVLDLVSLSGDVTPSTKLNDTVIARTSIQNDVVMTQQLRVYDEPEKFQ
FFKEPPRNTFGRAVAKKRTSIDSELGLKNWGAKNLGAIPLKTTIAQNSHKSPVQRYEYNL
VNATIRGSKKKLLEALKNGEDANESDNLGFTALYHAAAHNYTEICKILIENGALIDAHGG
EXCETALHAAVRWQAVDVVEYLLSKGANRRARNLKDETPMDLIKDDEMRAVFGRISHPIQ
MVYPSRKSKKYSVFLSTTLPNLNIERGKLSFSDLLQNTMNLENATHFVVQAGKNRGTEIS
VEILEAMLRGQYILTSEWLNACLEANDIVDEEMYEISTIIRNGQLLAXNSCSTARINYAR
MEPELFRGCHFYFCKHKYLPYRENEVKKLVRLAGGVILGREPKIEEYIESGLRPYHAKRA
GNNLNELFGLFVVYMPGQSIPQRVTKQKFISLITPIWIMECIAKFTLLRPEDQ
Download sequence
Identical sequences Bm1_01275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]