SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_01420 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_01420
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-21
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_01420
Sequence length 438
Comment | Brugia malayi conserved hypothetical protein (439 aa)
Sequence
MMEVERYPLHRAAFFNDTQSIARLINNGADLHFQDRQGNTALHISTMLGHKEATTLLLAH
NASVKSKNKDGWNSLMEAVSYGDRQIITAMLRKLKAQSRENMAARKPHLLKMLSEFGDFY
MELRWDFQSWLPLLTKILPSDVCKIYKYGTNLRLDTTLVDFTDRTWERGNISFIFSSDSD
RSKDQFLILDHEAKVFQRIRHEESETELDEEIDVLMSSDIVSAQMSTKPITFERTISGWI
FKHEKLEQVGDYNAVYYTVEGMSLITRKRREHLTAEDIKKNKAFMQSLAMGSLLAEDEFI
SLQHRKSLPPPRKTAITWEEYINAAAGLAPSLGRAQVLKQNTKKFKALVAMAEDFPLSVD
VLLDILEIVAPFKHFDKLRCFCKMKMPPGFPVRIEIPILPTISAKVTFQKFMFRNDLTPK
IFKIPKSYQEDANRFPDL
Download sequence
Identical sequences A0A0K0J3H0
Bm1_01420 XP_001891800.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]