SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02010 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_02010
Domain Number 1 Region: 9-181
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-17
Family AlkB-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_02010
Sequence length 212
Comment | Brugia malayi spermatogenesis associated 11, putative (213 aa)
Sequence
MKNVLLQCCTVIPNFITKDEEISLLDEINPHMKRMRYEKSHWDDAIHLYREREQLKWRKE
NEAILDRIRKHSFXKEDKQHLFVHILDLHEDGVIKPHIDSVRYCGDVITGLSLLSDAVMR
LRHKDRKDELIVDLFLQQRCLYRMAEFSRYEFYHEVLGKAESYFMEKPIPRSRRISIVCR
DLPRNVQENESHTASNIVGKRELLQRSDTERI
Download sequence
Identical sequences Bm1_02010 XP_001891909.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]