SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02140 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_02140
Domain Number 1 Region: 38-164
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000164
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_02140
Sequence length 172
Comment | Brugia malayi Lethal protein 805, isoform d, putative (172 aa)
Sequence
MSAYAASLQKLIVALILIYAIRGNEPRIRLRREIGGSQSLLTVEWEGIQTGDHPDDSVGG
FAVEYRAEKDTQWHVHDGIIPYKGPNLQYRVQIPRLPTGIAYFVRIKVLGKNGKILVETP
EIRARNEMVSIKCESDELTAPRNLEVTQTGQYSIAIAWEPPECGSVGEYHIE
Download sequence
Identical sequences A8NGN3
XP_001891935.1.25112 XP_001895360.1.25112 Bm1_02140 Bm1_19525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]