SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02380 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_02380
Domain Number 1 Region: 61-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-33
Family SPRY domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_02380
Sequence length 488
Comment | Brugia malayi SPRY domain containing protein (489 aa)
Sequence
MAMEVEVLQNDFDDAPLDDVVEVKSLSPDPAMRRRRPRYKVICAGERPKEVNERLLQLYP
FVDQKKTPLPTHWSHQDKAASLVVTNDYRNVAYADSGDPNQELNAKDAAAVRADHPIPIT
CGVYYFEVTIVCSGAECCMGVGLCERNVDLNRLPGWDRASYGYHGDDGNFFCSSGTGHAY
GPTFKMNDVIGCGVDFVRKSIFFTKNGRHLGIAIMEVENVVDLYPMIGLQKHGAIADSNF
GQYPFKYDIEQEFKDARNYTYEQICQVVLPQAKTGWMDRAISSWXLHEGYGRALAAFKKH
ADQNLDETGDVQMEKGEEESSDMLETRRVRQFAELKQLILDGEVGKAIDRARALCPDLLE
QNKELALLLNCQYYVEIYAKANNIIISSVSSRGSASSLSPKEETRPTQSSLSAISGGDSY
AQVYSRKGHPFTITASNENLGTFNPFKRRNDEWEPFVCVTRRSRTGNEGVQTDSNRFTRV
QASSSVIR
Download sequence
Identical sequences XP_001891979.1.25112 Bm1_02380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]