SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02820 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_02820
Domain Number - Region: 135-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000783
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 78-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 177-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.094
Further Details:      
 
Domain Number - Region: 111-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00615
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 51-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_02820
Sequence length 269
Comment | Brugia malayi EGF-like domain containing protein (270 aa)
Sequence
MTIPTDFRFTGSLLILSVVLQIPNIATITNPVFGNDENSMEHGVHYGRTNFSCFNGGSLI
NGRCHCQERFEGEACEIEPCLHGGRKSKAGKCHCPYGLTGERCEMVTQCIEGKGKLENGR
CKCEDRWTGIFCQSRMCHNGISVGSGEQIGGFCLCDIGFTGPFCETPIECNHGSITVENL
CSCAPNWVGEDCNQCAYEYQLIDGDCKLITTENSLIAVRNSKAVTLWSLILVIAAASFST
VLIAAVIIIYIKKCKRKPSRVGSDAGTDV
Download sequence
Identical sequences A0A0K0JC11 A0A0R3QJH0
Bm1_02820 XP_001892066.1.25112 Bm3832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]