SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02995 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_02995
Domain Number 1 Region: 129-243
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 31-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000182
Family I set domains 0.02
Further Details:      
 
Weak hits

Sequence:  Bm1_02995
Domain Number - Region: 220-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000754
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_02995
Sequence length 265
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (265 aa)
Sequence
MKIIGEFQKYILLNLSTGIPYGPPIRVQIDAPKNLHIPVGGRARWFCRVIGQRSAGIRLQ
WSKVGTAGLPSNAVQYDGELIINGVRESDAGQYRCTGSGDHQFATDDGTLNVEAKPRIPV
IGRPPPVMIDPLEQTVNVNDMVTYRCWVPGLSSCELKWYKEDIGGQLPHGVYQTDGMLKI
PHAQLEHAGSYICTASNEYGIGKSPPARLIVQKPIQRPRIDPQENTVAEGEPARFRCWVP
GDPTAILTWKMKGNGPLPPGVQQHD
Download sequence
Identical sequences XP_001892094.1.25112 Bm1_02995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]