SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_04010 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_04010
Domain Number 1 Region: 3-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000717
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 2 Region: 77-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 120-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000084
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 195-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 158-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000245
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 47-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000787
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_04010
Sequence length 251
Comment | Brugia malayi EGF-like domain containing protein (251 aa)
Sequence
MTDHCASSPCRNHATCINQGAQYLCECSLGFEGAHCEHNRNECDLLHKCSQEGTELCEDL
INGYKCNCRHGYTGELCEIHIDQCASEPCLNNGTCVDTGSQFRCDCPRGWKGNRCEEEDG
LCALNPCHNDAHCVNLVADYFCVCPEGVSGKDCEIAPNRCLGEPCHNGGVCGDFGSHLEC
TCPKDFIGVGCQYELDACQEGVCQNDAICELLEGGNYRCICEPGFTGQNCETNINDCSPS
PCPLAAICIDQ
Download sequence
Identical sequences XP_001892290.1.25112 Bm1_04010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]