SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_04365 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_04365
Domain Number 1 Region: 12-125
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000115
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_04365
Sequence length 126
Comment | Brugia malayi hypothetical protein (126 aa)
Sequence
MNAKFLEAIDLLRDNNVTQFEKLIKQFPQLLEIRRRGRSLLTYALLYDRLRALQIISKRS
KSSFDGEDCSESALHWIAKFDARKCCKYLLSLPRQYSEIPWIVIKNNRQITPIHLAAHYG
HVKILK
Download sequence
Identical sequences XP_001892357.1.25112 Bm1_04365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]