SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_05425 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_05425
Domain Number 1 Region: 138-211
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000363
Family PHD domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_05425
Sequence length 373
Comment | Brugia malayi Zinc finger in N-recognin family protein (374 aa)
Sequence
MEKDISGLDNVENDXGNHQNDTEQEDISEIPDDPLVTLSEVIEAHEELEAEAEALLGGAN
ANVCTYPEGYKPRQPLYSCRDCTSTTGPAALCYACSVNCHDGHELVELYTKRNFCCDCGN
SKFKNACTLYKEKKPLNERNQYNHNFDGLYCTCNRPYPCEEYDDCEMLQCIICEDWFHXQ
HLEETPDSVDTSEVEEVICRNCVTRFTFLLFYADGTYKEVCADNKLCKLKWLEANAKTDE
NSQPCSLFFNSYKWRNRLCQCKICSNFYEDNNLQFLTDLTDCMQTFVESHSNKSNDKPKD
DDRVMTNALIDVAGREGAITLFKGYEEMKRKLGNHLKRLADEGREVKKEDIDQFFQELEM
ERKRRREDILSQL
Download sequence
Identical sequences Bm1_05425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]