SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_05925 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_05925
Domain Number 1 Region: 25-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000559
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_05925
Sequence length 324
Comment | Brugia malayi EGF-like domain containing protein (325 aa)
Sequence
MNSFPRLSCLSLKYLDGNPSEPGRICAAQLCGLCNGHGDCIYNEATKNVTCSCVGGYTGE
FCEIEPSKTLLLLFLILAVLLLLLSLCLCMYFCSRLRCFRRKPETSIGSGREILSSDYYS
IPRAKLKRREVDDTAPAEVSSRQLQRYLDDGGSISGESSGSSVQFERRVITDITTHEIKK
TIYHDPETGQAIYEVTATASSSAGDGGHSQFLRPPIEIESEQHAGEQYPRSESXSRIDGS
GRGTIRESGSREYTATRTTRQMADDYDDKEAYSQEDEIDGAVFDRTTKLSTRHDFMPAEY
GHGGVERRRNEMSTMTKSHETSYY
Download sequence
Identical sequences Bm1_05925 XP_001892657.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]