SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_06225 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_06225
Domain Number 1 Region: 196-291
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-26
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 105-203
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 286-381
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 2-99
Classification Level Classification E-value
Superfamily Immunoglobulin 3.59e-17
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_06225
Sequence length 391
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (392 aa)
Sequence
MPVITEHPLDVIVAKGEPATLNCAAKGPDLQITWFKDGEPVITNNEEKNSHRLVLHTGAL
FLLRVNNGKGKDADSGTYYCVAKNKYGEVWSREASLKIAMLRDDFRIRPRPIQAVIGNRA
VLECSPPRGFPEPVVSWRKDERDLRPQDEDGIVLHPSGNLVIEKVQRSDAGFYQCVATNM
VGERVSNPARLSVYEKPYFLQKPQNLTVEVGSSVLFDCRVSGDPMPSISWKKRNQQMPVG
RAYIASDNRGLRIDKVQPNDAGEYICQAKNPAGSIETSALLNVHAAPSFTKTPRDVLVDS
GSTAKFRCEAEGQPQPALFWSREGQQEVFFPGHISSDGRIKVTFNGDLTVTDVRPADEGN
YVCAAMNLAGSSLTKATLKVMSKSKSCISKR
Download sequence
Identical sequences XP_001892714.1.25112 Bm1_06225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]