SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_06270 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_06270
Domain Number 1 Region: 144-217
Classification Level Classification E-value
Superfamily SET domain 0.0000265
Family Histone lysine methyltransferases 0.026
Further Details:      
 
Weak hits

Sequence:  Bm1_06270
Domain Number - Region: 43-137
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0196
Family PWWP domain 0.035
Further Details:      
 
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0224
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_06270
Sequence length 260
Comment | Brugia malayi hypothetical protein (261 aa)
Sequence
MACKSCIRSFCHSCVAGKNKIKDVKAENFEFVCDFCRCFDFPRIGDYVLAAYKSNFWPAR
SLHADLLPISLYSMNNLFGKLREPGYVLIQWVEGLDVPNYDVVTCRDLVPLPKTLNCSFW
KRMKAHSKIYKAAEAIYASSKAVVGIRRPLPQEVKASKYTRIKTNINMRLARALSDTTEL
GHCNCEPINGMRCTVAHNCLNRILMTECPEDCDSTYLGKRNALVGGTRRQILKRTTKLVT
SEKSLLPSQKMCTNNFFAAS
Download sequence
Identical sequences Bm1_06270 XP_001892723.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]