SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_07115 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_07115
Domain Number 1 Region: 236-640
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.23e-60
Family Ankyrin repeat 0.0000185
Further Details:      
 
Domain Number 2 Region: 5-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.2e-59
Family Ankyrin repeat 0.0000303
Further Details:      
 
Domain Number 3 Region: 510-565,681-870
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-42
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 859-985
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000337
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_07115
Sequence length 1045
Comment | Brugia malayi ankyrin repeat domain protein 28, putative (1046 aa)
Sequence
MNAELLKAVLLNDLRLLQGCIEKGIDVNEVDENGTSPLHLASFYGYHPIVNALIDARARV
DARDREWFTPLQRACFHNHPNTVKILINRGAKPNSATRQFMTSLHICAQVNALSCAEVIL
DNCDSIIDRPDWGGCPPLHYAASYGNSAFVEFLLKRNTNPSTKNKRGMTAAHWAALNGHS
DVLKLLFNSGTDMSLHDQQMRTILHYAAMSGDMDSVTFILENTSLPINNQCSAGYTPLHY
AVLNGRSRVAGILISNGANPFIASYFNGFIPLHIAAGFTEGTLSCDLLIEVTHEIGYQST
DGSTALHFACQYGRIARSKSLIAKDIPVNAATIQGVTPLHMASRHGHDLIVKHLLGAGAD
CSLKTKSGLTALHLAAFHGYVVVARTLCISGANVAEVDCIGRTALHMATQSASSNSEFMI
DYLLSTNIPVSKVDCKGCSALHYAARSGFFQAIQKLLAAGACANEQDQLGYTPLHYAVQS
PSDLALVSAKILLRADNTVIQVRDKSGFLPVHHAVKTGNLETVLFLIDAMSDATVPSSCH
PYHLTLYHIAARYNHAQLLQKLLAFYHARSMTLDKEQTAKISNTIGLEMDSLERIPIHYA
MSGGYQRCVDILLRTAIRKRALLRKDCFGITPLHAAAACGRTQNKKYGWERSGVLFENFL
PIVLSELKTPIMFAISNGFLDCFLTLLPKSDVKLFDKNGRGLMHRACSLRNELLCKELVN
KGADFKSADCNGVTPFHIAARSGDSAIVNYLLANGVEETADSTGLTAFDWAAMEGNECVL
HILHGVNKDANRSMATILAASRGHVEACQFLLQMNMEYANATDVRGRTALHHAARQGYTK
VVSTLLIAGANPSALDVFHISPLMAAASCSDPGYALEIIGLLIEQTAFLEAIDIAGNTVF
HHACMAGNEMEAVYLLNHIKPVPANGHAEHIINYQNTHGQTVLHLACKAGMITLIRNVLR
ISSYSLSLMDDKGRIPLVAAIENEAVIDCMLCMLDTFVGAVNKNATVRRFRKAECADSHF
CLPSCMEEAKVEVEEAEVEAEGDFY
Download sequence
Identical sequences XP_001892892.1.25112 Bm1_07115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]