SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_07340 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_07340
Domain Number 1 Region: 117-305
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.57e-49
Family Astacin 0.00079
Further Details:      
 
Domain Number 2 Region: 351-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-17
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 3 Region: 488-537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  Bm1_07340
Domain Number - Region: 309-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_07340
Sequence length 596
Comment | Brugia malayi zinc metalloproteinase toh-2 precursor ,
Sequence
putativeXXXXaaXMKEIAHSQAYGNRVFSRDSAVDSKKDVSISAEQPKTISKLTPYLF
EGDIFLSTKQAMNILDSLASKNKTNKKGQQRMAHDAPLYLFRGANEKGKRFAAEYDAKWF
QFPIKYRFDESLDILHISQILKALEIWQSNTCIKFENDQEASGDYIEFFEGDGCYSMVGR
FGGRQGISIGKGCERTGTIIHEVGHTLGLWHEQSRPDAEEYITVVKEYIIPSYISEFLTR
SEHEITTFNVPYDLGSVMHYGSTAFSIDQRSKTLLTKDPFYQMTIGQRDSLSFYNIKLIN
EAYCKGDCKEKNECKNGGYLNPSNCQSCLCPSGFGGSKCEMHASSESNSKCGGTLKAIID
WQYIESPGYPDGYPTNVICNWLIETDKEERIEISFEDNFGIFCSSTCVDYIELKIGNDLA
NTGYRICCYDKPNDSLVSAKYQAVIIFRATTGEDTGFKLKFRKTMKPAQTTPSLPKTTTT
APHTTIVGNDIWSEWGEWSQCSRSCGACGIKSRLRICKTAQCSGKVQQFLTCNLQACPVD
IRCTKVKFKNRLCADGNTCGKPGELLSSCSRPSCCPPFENVDGKCQTDQPLLIPLE
Download sequence
Identical sequences Bm1_07340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]