SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_08315 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_08315
Domain Number 1 Region: 76-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000667
Family EGF-type module 0.034
Further Details:      
 
Domain Number 2 Region: 20-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000671
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_08315
Sequence length 128
Comment | Brugia malayi EGF-like domain containing protein (129 aa)
Sequence
MVLINVALALLNCLVVLPSCFDPAKLCLNGEMCVKQITNKVHLTLCSCSVGYGGEKCEIL
YVWKAFPHYRNVTVVDRCKLGNICRNDGTCIDGICFCTDGFSGKICEKEMTIYEMDVRTS
GILCTAFC
Download sequence
Identical sequences XP_001893134.1.25112 Bm1_08315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]