SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_08415 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_08415
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000426
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_08415
Sequence length 248
Comment | Brugia malayi chromosome 14 open reading frame 169, putative (249 aa)
Sequence
MLYIPRGYIHQGFADKDVHSLQLTVSVCRNVTYADLLERVIPPALSNFAEQNVNIRKSLP
ARYLDMTGVLECDYPLLKTGTIKLHRFLDSIFSNFCKYIKELSEPDVDMMAREFMRTALP
PVLTKEEKDMTALCVAGSSLYGDKEHIFTKNTPIKLLRRHGQRLIYESEERCFIVHRMAN
SRVYEGRPEVLFDLDVELAEGFANLVNAYPRWCLVSDLKCNDAADNIRLAELLYSNGLLM
AEFREAMR
Download sequence
Identical sequences Bm1_08415 XP_001893154.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]