SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_08440 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_08440
Domain Number 1 Region: 60-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000379
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_08440
Sequence length 151
Comment | Brugia malayi Calcium binding EGF domain containing protein (152 aa)
Sequence
MEPFRCAKSSFCVNGCNLSPCPENGTCVLKSNYNEDLVGIYWNLWNVSCDCIEPGYIFRF
DVNKCVDINECLYINCEQTHGENWECVNLKGSYSCVCKLGFNPANNGCLPIQIYHGLSWK
GPAFAGVEKFSSKKTKKKENLQWKMLKSTIN
Download sequence
Identical sequences Bm1_08440 XP_001893159.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]